1y0u/1/1:B/1:A

Sequences
>1y0u-a1-m1-cB (length=85) [Search sequence]
GHSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRLDKGRSEEEIQTLSLSKKQLDYH
LKVLEAGFCIERVGERWVVTDAGKI
>1y0u-a1-m1-cA (length=86) [Search sequence]
GHSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRLDKGRSEEEIQTLSLSKKQLDYH
LKVLEAGFCIERVGERWVVTDAGKIV
Structure information
PDB ID 1y0u (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession O30069 O30069
Species 224325 (Archaeoglobus fulgidus DSM 4304) 224325 (Archaeoglobus fulgidus DSM 4304)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y0u-a1-m1-cB_1y0u-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1y0u-assembly1.cif.gz

[Back to Home]