1y2i/1/1:D/1:E

Sequences
>1y2i-a1-m1-cD (length=106) [Search sequence]
QFSTTPTLEGLTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIA
FEELGSQARALGADAVVGIDIDYETVGQNGSLVSVSGTAVKTRRNI
>1y2i-a1-m1-cE (length=106) [Search sequence]
QFSTTPTLEGLTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIA
FEELGSQARALGADAVVGIDIDYETVGQNGSLVSVSGTAVKTRRNI
Structure information
PDB ID 1y2i (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of MCSG Target APC27401 from Shigella flexneri
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q83LS2 Q83LS2
Species 198215 (Shigella flexneri 2a str. 2457T) 198215 (Shigella flexneri 2a str. 2457T)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y2i-a1-m1-cD_1y2i-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1y2i-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1y2i/1/1:A/1:B 1y2i/1/1:A/1:E 1y2i/1/1:B/1:C 1y2i/1/1:C/1:D

[Back to Home]