1y2w/1/1:A/2:A

Sequences
>1y2w-a1-m1-cA (length=142) [Search sequence]
TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDT
DESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKG
RRFAIEYTVTEGDNLKANLIIG
>1y2w-a1-m2-cA (length=142) [Search sequence]
TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDT
DESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKG
RRFAIEYTVTEGDNLKANLIIG
Structure information
PDB ID 1y2w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the orthorhombic form of the common edible mushroom (Agaricus bisporus) lectin in complex with T-antigen and N-acetylglucosamine
Assembly ID 1
Resolution 1.74Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
PubMed citation 15596442
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q00022 Q00022
Species 5341 (Agaricus bisporus) 5341 (Agaricus bisporus)
Function annotation BioLiP:1y2wA BioLiP:1y2wA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1y2w-a1-m1-cA_1y2w-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1y2w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1y2t/1/1:A/2:A 1y2t/1/1:B/2:B 1y2u/1/1:A/2:A 1y2u/1/1:B/2:B 1y2v/1/1:A/2:A 1y2v/1/1:B/2:B 1y2w/1/1:B/2:B 1y2x/1/1:A/1:D 1y2x/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 1y2t/1/2:A/2:B 1y2t/1/1:A/1:B 1y2u/1/1:A/1:B 1y2u/1/2:A/2:B 1y2v/1/1:A/1:B 1y2v/1/2:A/2:B 1y2w/1/1:A/1:B 1y2w/1/2:A/2:B 1y2x/1/1:A/1:B 1y2x/1/1:C/1:D
  • 1y2t/1/1:A/2:B 1y2t/1/1:B/2:A 1y2u/1/1:A/2:B 1y2u/1/1:B/2:A 1y2v/1/1:A/2:B 1y2v/1/1:B/2:A 1y2w/1/1:A/2:B 1y2w/1/1:B/2:A 1y2x/1/1:A/1:C 1y2x/1/1:B/1:D
  • [Back to Home]