1y3i/2/1:A/1:B

Sequences

>1y3i-a2-m1-cA (length=231) [Search sequence]

VLLVVHLVLVLGGDGTFLRAAELARNASIPVLGVNLGRIGFLAEAEAEAIDAVLEHVVAQ
DYRVEDRLTLDVVVRQGGRIVNRGWALNEVSLEKGPRLGVLGVVVEIDGRPVSAFGCDGV
LVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPEATIAIEIEADGHD
ALVFCDGRREMLIPAGSRLEVTRCVTSVKWARLDSAPFTDRLVRKFRLPVT

>1y3i-a2-m1-cB (length=231) [Search sequence]

Structure information

PDB ID	1y3i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Mycobacterium tuberculosis NAD kinase-NAD complex
Assembly ID	2
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	121
Sequence identity between the two chains	1.0
PubMed citation	15629142

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P9WHV7	P9WHV7
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)
Function annotation	BioLiP:1y3iA	BioLiP:1y3iB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1y3i-a2-m1-cA_1y3i-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1y3i-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1u0r/1/1:A/1:D 1u0r/1/1:B/1:C 1u0t/1/1:A/1:B 1u0t/1/2:A/2:B 1y3h/1/1:B/1:A 1y3h/1/2:B/2:A 1y3i/1/1:A/1:B 1y3i/1/2:A/2:B
Other dimers with similar sequences but different poses	1u0t/1/1:B/2:B 1u0r/1/1:B/1:A 1u0r/1/1:C/1:D 1u0t/1/1:A/2:A 1y3h/1/1:A/2:A 1y3h/1/1:B/2:B 1y3i/1/1:A/2:A 1y3i/1/1:B/2:B