1y47/3/1:B/3:B

Sequences
>1y47-a3-m1-cB (length=46) [Search sequence]
DYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETI
>1y47-a3-m3-cB (length=46) [Search sequence]
DYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETI
Structure information
PDB ID 1y47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural studies of designed alpha-helical hairpins
Assembly ID 3
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y47-a3-m1-cB_1y47-a3-m3-cB.pdb.gz
Full biological assembly
Download: 1y47-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1u7j/1/1:A/1:B 1y47/1/1:A/2:A

[Back to Home]