1y50/2/2:A/4:A

Sequences
>1y50-a2-m2-cA (length=87) [Search sequence]
AEKTFKVVSDSGIHARPATILVQTASKWNSEIQLEYNGKTVNLKSIMGVMSLGIPKGATI
KITAEGADAAEAMAALTDTLAKEGLAE
>1y50-a2-m4-cA (length=87) [Search sequence]
AEKTFKVVSDSGIHARPATILVQTASKWNSEIQLEYNGKTVNLKSIMGVMSLGIPKGATI
KITAEGADAAEAMAALTDTLAKEGLAE
Structure information
PDB ID 1y50 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr) F29W mutant domain_swapped dimer
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession P42013 P42013
Species 1422 (Geobacillus stearothermophilus) 1422 (Geobacillus stearothermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y50-a2-m2-cA_1y50-a2-m4-cA.pdb.gz
Full biological assembly
Download: 1y50-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1y50/2/3:A/4:A 1y50/1/1:A/2:A 1y50/2/1:A/2:A
  • [Back to Home]