1y66/1/1:D/1:A

Sequences
>1y66-a1-m1-cD (length=46) [Search sequence]
SEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQ
>1y66-a1-m1-cA (length=50) [Search sequence]
QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK
Structure information
PDB ID 1y66 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1y66-a1-m1-cD_1y66-a1-m1-cA.pdb.gz
Full biological assembly
Download: 1y66-assembly1.cif.gz

[Back to Home]