1y6x/3/1:A/5:A

Sequences
>1y6x-a3-m1-cA (length=86) [Search sequence]
VKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAE
EISQLLYWTQVLISRGLSLDDVYRKL
>1y6x-a3-m5-cA (length=86) [Search sequence]
VKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAE
EISQLLYWTQVLISRGLSLDDVYRKL
Structure information
PDB ID 1y6x (database links: RCSB PDB PDBe PDBj PDBsum)
Title The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
Assembly ID 3
Resolution 1.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 128
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 5
Chain ID A A
UniProt accession P9WMM9 P9WMM9
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y6x-a3-m1-cA_1y6x-a3-m5-cA.pdb.gz
Full biological assembly
Download: 1y6x-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1y6x/2/3:A/4:A 3c90/1/1:A/1:X 3c90/2/1:B/1:C

[Back to Home]