1y71/1/1:A/1:B

Sequences
>1y71-a1-m1-cA (length=107) [Search sequence]
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQERRALAFREQTNIPEQVK
KYEGEIPDYTESLKLALETQNSFSEDDSPFAERSLETLQQLKKDYKL
>1y71-a1-m1-cB (length=110) [Search sequence]
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQGFHERRALAFREQTNIPE
QVKKYEGEIPDYTESLKLALETQNSFSEDDSPFAERSLETLQQLKKDYKL
Structure information
PDB ID 1y71 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of kinase-associated protein B from Bacillus cereus
Assembly ID 1
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q816F1 Q816F1
Species 1396 (Bacillus cereus) 1396 (Bacillus cereus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y71-a1-m1-cA_1y71-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1y71-assembly1.cif.gz

[Back to Home]