1y7o/2/1:F/1:E

Sequences
>1y7o-a2-m1-cF (length=161) [Search sequence]
MIPVVISYDIYSRLLKDRIILTGPVEDNANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVS
AGLAIVDTNFIKADVQTIVGAASGTVIASSGAKGKRFLPNAEYIHQPAPEHLLKTRNTLE
KILAENSGQSEKVHADAERDNWSAQETLEYGFIDEIANNSL
>1y7o-a2-m1-cE (length=162) [Search sequence]
MIPVVIERSYDIYSRLLKDRIILTGPVEDNANSVIAQLLFLDAQDSTKDIYLYVNTPGGS
VSAGLAIVDTNFIKADVQTIVGAASGTVIASSGAKGKRFLPNAEYIHQPAPEHLLKTRNT
LEKILAENSGQSEKVHADAERDNWSAQETLEYGFIDEIANNS
Structure information
PDB ID 1y7o (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of Streptococcus pneumoniae A153P ClpP
Assembly ID 2
Resolution 2.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 84
Sequence identity between the two chains 0.994
PubMed citation 15701650
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession P63788 P63788
Species 1313 (Streptococcus pneumoniae) 1313 (Streptococcus pneumoniae)
Function annotation BioLiP:1y7oF BioLiP:1y7oE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y7o-a2-m1-cF_1y7o-a2-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1y7o-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1y7o/1/1:A/1:B 1y7o/1/1:A/1:G 1y7o/1/1:C/1:B 1y7o/1/1:C/1:D 1y7o/1/1:E/1:D 1y7o/1/1:F/1:E 1y7o/1/1:F/1:G 1y7o/1/2:A/2:B 1y7o/1/2:A/2:G 1y7o/1/2:C/2:B 1y7o/1/2:C/2:D 1y7o/1/2:E/2:D 1y7o/1/2:F/2:E 1y7o/1/2:F/2:G 1y7o/2/1:A/1:B 1y7o/2/1:A/1:G 1y7o/2/1:C/1:B 1y7o/2/1:C/1:D 1y7o/2/1:E/1:D 1y7o/2/1:F/1:G
Other dimers with similar sequences but different poses
  • 1y7o/1/1:A/2:A 1y7o/1/1:E/2:D 1y7o/1/1:F/2:C 1y7o/1/1:G/2:B 1y7o/1/2:E/1:D 1y7o/1/2:F/1:C 1y7o/1/2:G/1:B
  • [Back to Home]