1y9b/2/4:B/1:A

Sequences
>1y9b-a2-m4-cB (length=76) [Search sequence]
PRITARVDVDTQDLLAKAAALAGSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLEA
LDNPAVVNAKLKLASE
>1y9b-a2-m1-cA (length=79) [Search sequence]
TTLPRITARVDVDTQDLLAKAAALAGSSINSFVLNAAIEKAKQVIEREQALKLSQADAVL
LEALDNPAVVNAKLKLASE
Structure information
PDB ID 1y9b (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Conserved Putative Transcriptional Factor from Vibrio cholerae O1 biovar eltor str. N16961
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 1
Chain ID B A
UniProt accession Q9K2J6 Q9K2J6
Species 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1y9b-a2-m4-cB_1y9b-a2-m1-cA.pdb.gz
Full biological assembly
Download: 1y9b-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1y9b/2/4:B/2:A 1y9b/2/3:B/1:A
  • [Back to Home]