1y9b/2/4:B/2:A

Sequences

>1y9b-a2-m4-cB (length=76) [Search sequence]

PRITARVDVDTQDLLAKAAALAGSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLEA LDNPAVVNAKLKLASE

>1y9b-a2-m2-cA (length=79) [Search sequence]

TTLPRITARVDVDTQDLLAKAAALAGSSINSFVLNAAIEKAKQVIEREQALKLSQADAVL LEALDNPAVVNAKLKLASE

Structure information

PDB ID	1y9b (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Conserved Putative Transcriptional Factor from Vibrio cholerae O1 biovar eltor str. N16961
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	2
Chain ID	B	A
UniProt accession	Q9K2J6	Q9K2J6
Species	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1y9b-a2-m4-cB_1y9b-a2-m2-cA.pdb.gz

Full biological assembly Download: 1y9b-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1y9b/2/4:B/1:A 1y9b/2/3:B/2:A