1ycy/2/2:C/2:D

Sequences
>1ycy-a2-m2-cC (length=60) [Search sequence]
SLLEKVLKEWKGHKVAVSVGFTGTLEDFDEEVILLKDVVDVIGNRGKQLIGLEDINWILL
>1ycy-a2-m2-cD (length=60) [Search sequence]
SLLEKVLKEWKGHKVAVSVGFTGTLEDFDEEVILLKDVVDVIGNRGKQLIGLEDINWILL
Structure information
PDB ID 1ycy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID C D
UniProt accession Q8TZN2 Q8TZN2
Species 2261 (Pyrococcus furiosus) 2261 (Pyrococcus furiosus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ycy-a2-m2-cC_1ycy-a2-m2-cD.pdb.gz
Full biological assembly
Download: 1ycy-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ycy/1/1:A/1:B 1ycy/1/1:A/1:C 1ycy/1/1:B/2:D 1ycy/1/1:C/1:D 1ycy/1/1:D/2:B 1ycy/1/2:A/2:B 1ycy/1/2:A/2:C 1ycy/1/2:C/2:D 1ycy/1/3:A/3:B 1ycy/1/3:A/3:C 1ycy/1/3:B/4:D 1ycy/1/3:C/3:D 1ycy/1/3:D/4:B 1ycy/1/4:A/4:B 1ycy/1/4:A/4:C 1ycy/1/4:C/4:D 1ycy/2/1:A/1:B 1ycy/2/1:A/1:C 1ycy/2/1:B/2:D 1ycy/2/1:C/1:D 1ycy/2/1:D/2:B 1ycy/2/2:A/2:B 1ycy/2/2:A/2:C
Other dimers with similar sequences but different poses
  • 1ycy/1/2:C/4:D 1ycy/1/1:A/4:B 1ycy/1/1:B/4:A 1ycy/1/1:C/3:D 1ycy/1/1:D/3:C 1ycy/1/2:A/3:B 1ycy/1/2:B/3:A 1ycy/1/2:D/4:C
  • [Back to Home]