1yd6/2/1:C/2:D

Sequences

>1yd6-a2-m1-cC (length=94) [Search sequence]

MNERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEI ADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLK

>1yd6-a2-m2-cD (length=96) [Search sequence]

NERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEIA DFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDK

Structure information

PDB ID	1yd6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the GIY-YIG N-terminal endonuclease domain of UvrC from Bacillus caldotenax
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	C	D
UniProt accession	Q5KWH6	Q5KWH6
Species	1395 ([Bacillus] caldotenax)	1395 ([Bacillus] caldotenax)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1yd6-a2-m1-cC_1yd6-a2-m2-cD.pdb.gz

Full biological assembly Download: 1yd6-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1yd6/2/2:A/2:D 1yd6/1/1:A/1:D 1yd6/1/1:B/1:A 1yd6/1/1:B/1:C 1yd6/1/1:C/1:D 1yd6/2/1:A/1:D 1yd6/2/1:B/1:A 1yd6/2/1:B/1:C 1yd6/2/1:C/1:D 1yd6/2/2:B/2:A 1yd6/2/2:B/2:C 1yd6/2/2:C/2:D 1yd6/2/2:C/1:A 1yd6/2/1:C/2:A 1yd6/2/1:D/2:D