1yd6/2/2:A/2:D

Sequences
>1yd6-a2-m2-cA (length=95) [Search sequence]
MNERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEI
ADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKD
>1yd6-a2-m2-cD (length=96) [Search sequence]
NERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEIA
DFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDK
Structure information
PDB ID 1yd6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the GIY-YIG N-terminal endonuclease domain of UvrC from Bacillus caldotenax
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A D
UniProt accession Q5KWH6 Q5KWH6
Species 1395 ([Bacillus] caldotenax) 1395 ([Bacillus] caldotenax)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1yd6-a2-m2-cA_1yd6-a2-m2-cD.pdb.gz
Full biological assembly
Download: 1yd6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1yd6/1/1:A/1:D 1yd6/1/1:B/1:A 1yd6/1/1:B/1:C 1yd6/1/1:C/1:D 1yd6/2/1:A/1:D 1yd6/2/1:B/1:A 1yd6/2/1:B/1:C 1yd6/2/1:C/1:D 1yd6/2/2:B/2:A 1yd6/2/2:B/2:C 1yd6/2/2:C/2:D
Other dimers with similar sequences but different poses
  • 1yd6/2/2:C/1:A 1yd6/2/1:C/2:A 1yd6/2/1:D/2:D
  • 1yd6/2/1:C/2:D 1yd6/2/2:C/1:D
  • [Back to Home]