1yd6/2/2:C/1:A

Sequences
>1yd6-a2-m2-cC (length=94) [Search sequence]
MNERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEI
ADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLK
>1yd6-a2-m1-cA (length=95) [Search sequence]
MNERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFTGTHDGKTQRLVEEI
ADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKD
Structure information
PDB ID 1yd6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the GIY-YIG N-terminal endonuclease domain of UvrC from Bacillus caldotenax
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C A
UniProt accession Q5KWH6 Q5KWH6
Species 1395 ([Bacillus] caldotenax) 1395 ([Bacillus] caldotenax)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1yd6-a2-m2-cC_1yd6-a2-m1-cA.pdb.gz
Full biological assembly
Download: 1yd6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1yd6/2/1:C/2:A 1yd6/2/1:D/2:D
Other dimers with similar sequences but different poses
  • 1yd6/2/2:A/2:D 1yd6/1/1:A/1:D 1yd6/1/1:B/1:A 1yd6/1/1:B/1:C 1yd6/1/1:C/1:D 1yd6/2/1:A/1:D 1yd6/2/1:B/1:A 1yd6/2/1:B/1:C 1yd6/2/1:C/1:D 1yd6/2/2:B/2:A 1yd6/2/2:B/2:C 1yd6/2/2:C/2:D
  • 1yd6/2/1:C/2:D 1yd6/2/2:C/1:D
  • [Back to Home]