1ylf/2/1:C/2:C

Sequences
>1ylf-a2-m1-cC (length=115) [Search sequence]
ISSRFSIAVHILSILKNNPSSLCTSDYAESVNTNPVVIRKISYLKQAGFVYVNRGPGGAG
LLKDLHEITLLDVYHAVNVGANIQAVLEIILIQAQSAEEVLRNITGQLFETLQEK
>1ylf-a2-m2-cC (length=115) [Search sequence]
ISSRFSIAVHILSILKNNPSSLCTSDYAESVNTNPVVIRKISYLKQAGFVYVNRGPGGAG
LLKDLHEITLLDVYHAVNVGANIQAVLEIILIQAQSAEEVLRNITGQLFETLQEK
Structure information
PDB ID 1ylf (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q81EX1 Q81EX1
Species 226900 (Bacillus cereus ATCC 14579) 226900 (Bacillus cereus ATCC 14579)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1ylf-a2-m1-cC_1ylf-a2-m2-cC.pdb.gz
Full biological assembly
Download: 1ylf-assembly2.cif.gz

[Back to Home]