1ylf/2/2:A/2:C

Sequences

>1ylf-a2-m2-cA (length=113) [Search sequence]

KISSRFSIAVHILSILKNNPSSLCTSDYAESVNTNPVVIRKISYLKQAGFVYVNGGAGLL KDLHEITLLDVYHAVNVIGANIQAVLEIILIQAQSAEEVLRNITGQLFETLQE

>1ylf-a2-m2-cC (length=115) [Search sequence]

ISSRFSIAVHILSILKNNPSSLCTSDYAESVNTNPVVIRKISYLKQAGFVYVNRGPGGAG LLKDLHEITLLDVYHAVNVGANIQAVLEIILIQAQSAEEVLRNITGQLFETLQEK

Structure information

PDB ID	1ylf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
Assembly ID	2
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	0.982

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	C
UniProt accession	Q81EX1	Q81EX1
Species	226900 (Bacillus cereus ATCC 14579)	226900 (Bacillus cereus ATCC 14579)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ylf-a2-m2-cA_1ylf-a2-m2-cC.pdb.gz

Full biological assembly Download: 1ylf-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ylf/1/1:A/1:C 1ylf/2/1:A/1:C