1ynr/1/1:D/1:A

Sequences
>1ynr-a1-m1-cD (length=79) [Search sequence]
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMP
PQNVTDAEAKQLAQWILSI
>1ynr-a1-m1-cA (length=80) [Search sequence]
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMP
PQNVTDAEAKQLAQWILSIK
Structure information
PDB ID 1ynr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 15883159
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession P15452 P15452
Species 940 (Hydrogenobacter thermophilus) 940 (Hydrogenobacter thermophilus)
Function annotation BioLiP:1ynrD BioLiP:1ynrA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ynr-a1-m1-cD_1ynr-a1-m1-cA.pdb.gz
Full biological assembly
Download: 1ynr-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1ynr/1/1:D/1:C 1ynr/1/1:B/1:A
  • 4zid/1/1:A/2:A 3vym/1/1:A/2:A
  • 5aur/2/1:E/1:G 5aur/1/1:A/1:C
  • [Back to Home]