1yqh/1/2:B/2:A

Sequences
>1yqh-a1-m2-cB (length=98) [Search sequence]
SQQVTSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAETTLEGELDVLLDVVKRAQQ
ACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA
>1yqh-a1-m2-cA (length=101) [Search sequence]
SNASQQVTSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAETTLEGELDVLLDVVKR
AQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA
Structure information
PDB ID 1yqh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of domain of unknown function DUF77 from Bacillus cereus
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession Q81IG4 Q81IG4
Species 226900 (Bacillus cereus ATCC 14579) 226900 (Bacillus cereus ATCC 14579)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1yqh-a1-m2-cB_1yqh-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1yqh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1yqh/1/1:B/2:B 1yqh/1/1:A/2:A
  • [Back to Home]