1yra/1/1:A/1:B

Sequences

>1yra-a1-m1-cA (length=260) [Search sequence]

MRGSHHHHHHGMASMIVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEP
SIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQM
ETFLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNK
VDLLSEEEKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTEVLPPVRVLYLSAKT
REGFEDLETLAYEHYCTCGD

>1yra-a1-m1-cB (length=261) [Search sequence]

Structure information

PDB ID	1yra (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PAB0955 crystal structure : a GTPase in GDP bound form from Pyrococcus abyssi
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	137
Sequence identity between the two chains	1.0
PubMed citation	17468740

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9UYR9	Q9UYR9
Species	29292 (Pyrococcus abyssi)	29292 (Pyrococcus abyssi)
Function annotation	BioLiP:1yraA	BioLiP:1yraB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1yra-a1-m1-cA_1yra-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1yra-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1yr6/1/1:A/2:A 1yr7/1/1:A/2:A 1yr8/1/1:A/2:A 1yr9/1/1:A/2:A 1yrb/1/1:A/1:B 2oxr/1/1:A/2:A