1ysf/1/1:A/1:B

Sequences
>1ysf-a1-m1-cA (length=52) [Search sequence]
FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN
>1ysf-a1-m1-cB (length=52) [Search sequence]
FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN
Structure information
PDB ID 1ysf (database links: RCSB PDB PDBe PDBj PDBsum)
Title The solution structure of the N-domain of the transcription factor abrB
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 137
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P08874 P08874
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1ysf-a1-m1-cA_1ysf-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1ysf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1yfb/1/1:A/1:B 2k1n/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2ro4/1/1:A/1:B 1z0r/1/1:A/1:B
    		•

    [Back to Home]