1yut/1/1:A/1:B

Sequences
>1yut-a1-m1-cA (length=98) [Search sequence]
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
>1yut-a1-m1-cB (length=98) [Search sequence]
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Structure information
PDB ID 1yut (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of Calcium-S100A13 (minimized mean structure)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 111
Sequence identity between the two chains 1.0
PubMed citation 16145699
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q99584 Q99584
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1yutA BioLiP:1yutB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1yut-a1-m1-cA_1yut-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1yut-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1yuu/1/1:A/1:B 2kot/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1yus/1/1:A/1:B 1yur/1/1:A/1:B
  • 2ki6/1/1:C/1:D 2k8m/1/1:B/1:C 2ki4/1/1:B/1:C 2l5x/1/1:B/1:C 2le9/1/1:B/1:C
  • [Back to Home]