1yvs/2/3:A/6:A

Sequences
>1yvs-a2-m3-cA (length=108) [Search sequence]
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGK
LPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
>1yvs-a2-m6-cA (length=108) [Search sequence]
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGK
LPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Structure information
PDB ID 1yvs (database links: RCSB PDB PDBe PDBj PDBsum)
Title Trimeric domain swapped barnase
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession P00648 P00648
Species 1390 (Bacillus amyloliquefaciens) 1390 (Bacillus amyloliquefaciens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1yvs-a2-m3-cA_1yvs-a2-m6-cA.pdb.gz
Full biological assembly
Download: 1yvs-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1yvs/2/1:A/5:A 1yvs/2/2:A/4:A
Other dimers with similar sequences but different poses
  • 1yvs/2/5:A/6:A 1yvs/1/1:A/2:A 1yvs/1/1:A/3:A 1yvs/1/2:A/3:A 1yvs/2/1:A/2:A 1yvs/2/1:A/3:A 1yvs/2/2:A/3:A 1yvs/2/4:A/5:A 1yvs/2/4:A/6:A
  • 3kch/3/1:C/4:C 3kch/1/1:A/2:A 3kch/2/1:B/3:B
  • [Back to Home]