1yvw/1/1:A/1:D

Sequences
>1yvw-a1-m1-cA (length=90) [Search sequence]
AFKLLYKTIEERKGSPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVVKEV
DVFYHCFVLLAEKNIALEDVREVKERNGKL
>1yvw-a1-m1-cD (length=90) [Search sequence]
AFKLLYKTIEERKGSPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVVKEV
DVFYHCFVLLAEKNIALEDVREVKERNGKL
Structure information
PDB ID 1yvw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession Q81G00 Q81G00
Species 1396 (Bacillus cereus) 1396 (Bacillus cereus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1yvw-a1-m1-cA_1yvw-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1yvw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1yvw/1/1:C/1:D 1yvw/1/1:A/1:B
  • 1yvw/1/1:B/1:D 1yvw/1/1:A/1:C
    		•

    [Back to Home]