1yxb/2/1:G/1:H

Sequences

>1yxb-a2-m1-cG (length=81) [Search sequence]

KTFEELFTELQHKAANTSRTAELVDKGVHAIGKKVVEEAAEVWAAEYEGKDAAAEEISQL LYHVQVVARGISLDDVYAHLL

>1yxb-a2-m1-cH (length=81) [Search sequence]

KTFEELFTELQHKAANTSRTAELVDKGVHAIGKKVVEEAAEVWAAEYEGKDAAAEEISQL LYHVQVVARGISLDDVYAHLL

Structure information

PDB ID	1yxb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
Assembly ID	2
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	119
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	Q9EWK0	Q9EWK0
Species	1902 (Streptomyces coelicolor)	1902 (Streptomyces coelicolor)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1yxb-a2-m1-cG_1yxb-a2-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1yxb-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1yxb/1/1:A/1:B 1yxb/1/1:C/1:D 1yxb/2/1:E/1:F
Other dimers with similar sequences but different poses	1yxb/2/1:E/1:H 1yxb/1/1:A/1:D 1yxb/1/1:B/1:C 1yxb/2/1:F/1:G