1z41/2/1:A/1:B

Sequences

>1z41-a2-m1-cA (length=327) [Search sequence]

ARKLFTPITIKDTLKNRIVSPCYSSHEKDGKLTPFHAHYISRAIGQVGLIIVEASAVNPQ
GRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGRKAELEGDIFAPSAIAFDE
QSATPVESAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYG
GSPENRYRFLREIIDEVKQVWDGPLFVRVSASDYTDKGLDIADHIGFAKWKEQGVDLIDC
SSGALVHADINVFPGYQVSFAEKIREQADATGAVGITDGSAEEILQNGRADLIFIGRELL
RDPFFARTAAKQLNTEIPAPVQYERGW

>1z41-a2-m1-cB (length=327) [Search sequence]

Structure information

PDB ID	1z41 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of oxidized YqjM from Bacillus subtilis
Assembly ID	2
Resolution	1.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	73
Sequence identity between the two chains	1.0
PubMed citation	15890652

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P54550	P54550
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)
Function annotation	BioLiP:1z41A	BioLiP:1z41B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1z41-a2-m1-cA_1z41-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1z41-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1z41/1/1:A/1:B 1z41/1/2:A/2:B 1z42/1/1:A/1:B 1z42/1/2:A/2:B 1z42/2/1:A/1:B 1z44/1/1:A/1:B 1z44/1/2:A/2:B 1z44/2/1:A/1:B 1z48/1/1:A/1:B 1z48/1/2:A/2:B
Other dimers with similar sequences but different poses	1z41/1/1:B/2:B 1z41/1/1:A/2:A 1z42/1/1:A/2:A 1z42/1/1:B/2:B 1z44/1/1:A/2:A 1z44/1/1:B/2:B 1z48/1/1:A/2:A 1z48/1/1:B/2:B