1z9f/2/3:A/4:A

Sequences
>1z9f-a2-m3-cA (length=89) [Search sequence]
HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKG
RLVLVEGEMRMRRKRVSPEVVANVVRFMD
>1z9f-a2-m4-cA (length=89) [Search sequence]
HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKG
RLVLVEGEMRMRRKRVSPEVVANVVRFMD
Structure information
PDB ID 1z9f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of single stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 78
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession Q9WZ73 Q9WZ73
Species 2336 (Thermotoga maritima) 2336 (Thermotoga maritima)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1z9f-a2-m3-cA_1z9f-a2-m4-cA.pdb.gz
Full biological assembly
Download: 1z9f-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1z9f/1/1:A/2:A 1z9f/2/1:A/2:A
Other dimers with similar sequences but different poses
  • 1z9f/2/1:A/4:A 1z9f/2/2:A/3:A
  • [Back to Home]