1z9o/1/1:B/1:E

Sequences
>1z9o-a1-m1-cB (length=119) [Search sequence]
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPG
SIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVWKEAKPDELMDSKLRCVFEM
>1z9o-a1-m1-cE (length=119) [Search sequence]
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPG
SIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVWKEAKPDELMDSKLRCVFEM
Structure information
PDB ID 1z9o (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.9 Angstrom Crystal Structure of the Rat VAP-A MSP Homology Domain in Complex with the Rat ORP1 FFAT Motif
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 16004875
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B E
UniProt accession Q9Z270 Q9Z270
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:1z9oB BioLiP:1z9oE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1z9o-a1-m1-cB_1z9o-a1-m1-cE.pdb.gz
Full biological assembly
Download: 1z9o-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1z9o/1/1:E/1:F 1z9o/1/1:A/1:B 1z9o/1/1:C/1:D
  • [Back to Home]