1zcp/1/1:A/1:B

Sequences
>1zcp-a1-m1-cA (length=106) [Search sequence]
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNID
QNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
>1zcp-a1-m1-cB (length=106) [Search sequence]
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNID
QNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Structure information
PDB ID 1zcp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a catalytic site mutant E. coli TrxA (CACA)
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0AA25 P0AA25
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1zcp-a1-m1-cA_1zcp-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1zcp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zcp/2/1:C/1:D 4hu7/3/2:B/1:A
Other dimers with similar sequences but different poses
  • 2fch/8/1:B/1:D 2eiq/3/1:A/2:A 2fch/10/1:B/1:D 2fch/12/1:B/1:D 2fch/8/1:C/1:F 2fch/9/1:A/1:E 2trx/3/1:A/2:A 2trx/4/1:B/3:B 5e4w/2/1:B/1:A
  • 2fch/8/1:B/1:C 2fch/10/1:B/1:C
  • 2fch/8/1:C/1:D 2fch/10/1:C/1:D
  • 2fch/8/1:F/1:G 2fch/11/1:F/1:G
  • 3dxb/5/1:F/1:A 3dxb/1/1:F/1:A 3dxb/2/1:B/1:D 3dxb/5/1:B/1:D 6lur/1/1:G/1:H
  • 6lur/1/1:A/1:D 3dxb/3/1:C/1:G 3dxb/4/1:E/1:H 3dxb/5/1:C/1:G 3dxb/5/1:E/1:H 6lur/1/1:B/1:C 6lur/1/1:E/1:F
  • 3dxb/5/1:F/1:D 3dxb/5/1:B/1:A 6lur/1/1:E/1:G
  • 3dxb/5/1:E/1:G 3dxb/5/1:C/1:H 6lur/1/1:A/1:C 6lur/1/1:B/1:D 6lur/1/1:B/1:F 6lur/1/1:C/1:E
  • 3dxb/5/1:B/1:G 3dxb/5/1:E/1:C 3dxb/5/1:F/1:H 6lur/1/1:A/1:H 6lur/1/1:B/1:E 6lur/1/1:C/1:D 6lur/1/1:F/1:G
  • 3dxb/5/1:B/1:C 3dxb/5/1:E/1:F 6lur/1/1:H/1:D
  • 3dxb/5/1:G/1:D 3dxb/5/1:H/1:A 6lur/1/1:A/1:G 6lur/1/1:F/1:H
  • [Back to Home]