1zes/2/1:B/1:C

Sequences
>1zes-a2-m1-cB (length=118) [Search sequence]
RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNWPDLILLDWMLPGGSGIQF
IKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR
>1zes-a2-m1-cC (length=120) [Search sequence]
RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGI
QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR
Structure information
PDB ID 1zes (database links: RCSB PDB PDBe PDBj PDBsum)
Title BeF3- activated PhoB receiver domain
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
PubMed citation 16154092
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P0AFJ5 P0AFJ5
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:1zesB BioLiP:1zesC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1zes-a2-m1-cB_1zes-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1zes-assembly2.cif.gz
Similar dimers

[Back to Home]