1zs4/1/1:D/1:A

Sequences
>1zs4-a1-m1-cD (length=73) [Search sequence]
RNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVVDDD
MARLARQVAAILT
>1zs4-a1-m1-cA (length=82) [Search sequence]
GSHMANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLE
WGVVDDDMARLARQVAAILTNK
Structure information
PDB ID 1zs4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of bacteriophage lambda cII protein in complex with DNA
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 16039594
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession P03042 P03042
Species 10710 (Lambdavirus lambda) 10710 (Lambdavirus lambda)
Function annotation BioLiP:1zs4D BioLiP:1zs4A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1zs4-a1-m1-cD_1zs4-a1-m1-cA.pdb.gz
Full biological assembly
Download: 1zs4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1xwr/1/1:B/1:A 1zpq/1/1:A/1:B 1zs4/1/1:A/1:B 8igr/1/1:B/1:A
  • 1xwr/1/1:D/1:A 1zpq/1/1:A/1:C
  • 1xwr/1/1:B/1:D 1zpq/1/1:B/1:C
  • 1xwr/1/1:C/1:D 1zpq/1/1:C/1:D 1zs4/1/1:D/1:C 8igr/1/1:D/1:C
  • 1zs4/1/1:C/1:A 8igr/1/1:A/1:C
  • 1zs4/1/1:C/1:B 8igr/1/1:B/1:C
  • [Back to Home]