1ztc/1/1:D/1:A

Sequences

>1ztc-a1-m1-cD (length=206) [Search sequence]

HHELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSDELEEKFSELGISPD
DITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVL
LKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSV
QVKNFLDRVGRIDLLVFPHDAPLKPE

>1ztc-a1-m1-cA (length=207) [Search sequence]

Structure information

PDB ID	1ztc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative metallo-beta-lactamase (tm0894) from Thermotoga maritima at 2.10 A resolution
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q9WZZ6	Q9WZZ6
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1ztc-a1-m1-cD_1ztc-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1ztc-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1ztc/1/1:D/1:B 1ztc/1/1:C/1:A