1zuy/1/1:A/1:B

Sequences
>1zuy-a1-m1-cA (length=58) [Search sequence]
PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH
>1zuy-a1-m1-cB (length=58) [Search sequence]
PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH
Structure information
PDB ID 1zuy (database links: RCSB PDB PDBe PDBj PDBsum)
Title High-resolution structure of yeast Myo5 SH3 domain
Assembly ID 1
Resolution 1.39Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q04439 Q04439
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1zuy-a1-m1-cA_1zuy-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1zuy-assembly1.cif.gz

[Back to Home]