1zw0/7/5:G/7:E

Sequences
>1zw0-a7-m5-cG (length=54) [Search sequence]
TQLEEQLHNVETVRSITMQLEMALTKLKKDMMWQRESKALESAIAIIHYVAGDL
>1zw0-a7-m7-cE (length=65) [Search sequence]
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHY
VAGDL
Structure information
PDB ID 1zw0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Yersinia Type III Secretion protein YscE
Assembly ID 7
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 7
Chain ID G E
UniProt accession O68692 O68692
Species 632 (Yersinia pestis) 632 (Yersinia pestis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1zw0-a7-m5-cG_1zw0-a7-m7-cE.pdb.gz
Full biological assembly
Download: 1zw0-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1zw0/9/1:B/5:H 1zw0/10/1:B/5:H 1zw0/12/1:B/5:H 1zw0/13/1:B/5:H 1zw0/14/1:B/5:H 1zw0/6/1:B/5:H 1zw0/6/2:B/6:H 1zw0/7/1:B/5:H
  • 1zw0/9/5:G/5:H 1zw0/10/1:C/1:D 1zw0/10/5:G/5:H 1zw0/11/1:C/1:D 1zw0/11/1:G/1:H 1zw0/12/5:G/5:H 1zw0/13/5:G/5:H 1zw0/14/5:G/5:H 1zw0/15/10:C/10:D 1zw0/2/1:C/1:D 1zw0/4/1:G/1:H 1zw0/5/1:C/1:D 1zw0/5/1:G/1:H 1zw0/5/2:C/2:D 1zw0/5/2:G/2:H 1zw0/6/1:C/1:D 1zw0/6/2:C/2:D 1zw0/6/5:G/5:H 1zw0/6/6:G/6:H 1zw0/7/1:C/1:D 1zw0/7/5:G/5:H 1zw0/8/1:C/1:D 1zw0/8/1:G/1:H 1zw0/9/1:C/1:D
  • 1zw0/8/1:C/1:H 1zw0/11/1:C/1:H 1zw0/5/1:C/1:H 1zw0/5/2:C/2:H
  • 1zw0/6/1:B/2:A 1zw0/5/3:B/4:A
    		•

    [Back to Home]