1zw0/8/1:D/1:H

Sequences
>1zw0-a8-m1-cD (length=66) [Search sequence]
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHY
VAGDLK
>1zw0-a8-m1-cH (length=66) [Search sequence]
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHY
VAGDLK
Structure information
PDB ID 1zw0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Yersinia Type III Secretion protein YscE
Assembly ID 8
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D H
UniProt accession O68692 O68692
Species 632 (Yersinia pestis) 632 (Yersinia pestis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1zw0-a8-m1-cD_1zw0-a8-m1-cH.pdb.gz
Full biological assembly
Download: 1zw0-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zw0/11/1:D/1:H 1zw0/5/1:D/1:H 1zw0/5/2:D/2:H
Other dimers with similar sequences but different poses
  • 1zw0/9/1:B/1:A 1zw0/10/1:B/1:A 1zw0/11/3:B/3:A 1zw0/12/1:B/1:A 1zw0/12/7:F/7:E 1zw0/13/1:B/1:A 1zw0/13/9:F/9:E 1zw0/14/1:B/1:A 1zw0/15/1:F/1:E 1zw0/1/1:B/1:A 1zw0/3/1:F/1:E 1zw0/5/1:F/1:E 1zw0/5/2:F/2:E 1zw0/5/3:B/3:A 1zw0/5/4:B/4:A 1zw0/6/1:B/1:A 1zw0/6/2:B/2:A 1zw0/6/5:F/5:E 1zw0/6/6:F/6:E 1zw0/7/1:B/1:A 1zw0/7/7:F/7:E 1zw0/8/3:B/3:A 1zw0/8/8:F/8:E 1zw0/9/9:F/9:E
  • 1zw0/9/1:C/1:A 1zw0/10/1:C/1:A 1zw0/6/1:C/1:A 1zw0/6/2:C/2:A 1zw0/7/1:C/1:A
  • 1zw0/8/1:G/1:D 1zw0/11/1:G/1:D 1zw0/5/1:G/1:D 1zw0/5/2:G/2:D
  • 1zw0/8/3:B/1:H 1zw0/11/3:B/1:H 1zw0/15/1:E/10:D 1zw0/5/3:B/1:H 1zw0/5/4:B/2:H 1zw0/7/7:E/1:D
  • 1zw0/9/9:F/1:A 1zw0/13/9:F/1:A 1zw0/8/8:F/3:A
  • 1zw0/6/6:E/6:H 1zw0/5/1:E/1:H 1zw0/5/2:E/2:H 1zw0/5/4:B/3:A 1zw0/6/2:B/1:A 1zw0/6/5:E/5:H
  • [Back to Home]