1zw0/9/5:G/5:H

Sequences
>1zw0-a9-m5-cG (length=54) [Search sequence]
TQLEEQLHNVETVRSITMQLEMALTKLKKDMMWQRESKALESAIAIIHYVAGDL
>1zw0-a9-m5-cH (length=66) [Search sequence]
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHY
VAGDLK
Structure information
PDB ID 1zw0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Yersinia Type III Secretion protein YscE
Assembly ID 9
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 5
Chain ID G H
UniProt accession O68692 O68692
Species 632 (Yersinia pestis) 632 (Yersinia pestis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1zw0-a9-m5-cG_1zw0-a9-m5-cH.pdb.gz
Full biological assembly
Download: 1zw0-assembly9.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zw0/10/1:C/1:D 1zw0/10/5:G/5:H 1zw0/11/1:C/1:D 1zw0/11/1:G/1:H 1zw0/12/5:G/5:H 1zw0/13/5:G/5:H 1zw0/14/5:G/5:H 1zw0/15/10:C/10:D 1zw0/2/1:C/1:D 1zw0/4/1:G/1:H 1zw0/5/1:C/1:D 1zw0/5/1:G/1:H 1zw0/5/2:C/2:D 1zw0/5/2:G/2:H 1zw0/6/1:C/1:D 1zw0/6/2:C/2:D 1zw0/6/5:G/5:H 1zw0/6/6:G/6:H 1zw0/7/1:C/1:D 1zw0/7/5:G/5:H 1zw0/8/1:C/1:D 1zw0/8/1:G/1:H 1zw0/9/1:C/1:D
Other dimers with similar sequences but different poses
  • 1zw0/9/1:B/5:H 1zw0/10/1:B/5:H 1zw0/12/1:B/5:H 1zw0/13/1:B/5:H 1zw0/14/1:B/5:H 1zw0/6/1:B/5:H 1zw0/6/2:B/6:H 1zw0/7/1:B/5:H
  • 1zw0/8/1:C/1:H 1zw0/11/1:C/1:H 1zw0/5/1:C/1:H 1zw0/5/2:C/2:H
  • 1zw0/7/5:G/7:E 1zw0/12/5:G/7:E
  • 1zw0/6/1:B/2:A 1zw0/5/3:B/4:A
  • [Back to Home]