1zx3/3/1:A/2:A

Sequences
>1zx3-a3-m1-cA (length=83) [Search sequence]
EVQQPDPRKNWIENDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLE
ETNTEYQNQQRKLRKTYIEYYDR
>1zx3-a3-m2-cA (length=83) [Search sequence]
EVQQPDPRKNWIENDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLE
ETNTEYQNQQRKLRKTYIEYYDR
Structure information
PDB ID 1zx3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of NE0241 Protein of Unknown Function from Nitrosomonas europaea
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q82XL7 Q82XL7
Species 228410 (Nitrosomonas europaea ATCC 19718) 228410 (Nitrosomonas europaea ATCC 19718)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1zx3-a3-m1-cA_1zx3-a3-m2-cA.pdb.gz
Full biological assembly
Download: 1zx3-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zx3/2/1:A/2:A 1zx3/2/3:A/4:A
Other dimers with similar sequences but different poses
  • 1zx3/2/2:A/4:A 1zx3/2/1:A/3:A
  • [Back to Home]