1zzj/1/1:C/1:A

Sequences
>1zzj-a1-m1-cC (length=74) [Search sequence]
GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ
DQIQNAQYLLQNSV
>1zzj-a1-m1-cA (length=75) [Search sequence]
AMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQD
QIQNAQYLLQNSVKQ
Structure information
PDB ID 1zzj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 0.986
PubMed citation 16004877
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P61978 P61978
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1zzjA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1zzj-a1-m1-cC_1zzj-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1zzj-assembly1.cif.gz

[Back to Home]