2a1f/3/1:D/1:C

Sequences

>2a1f-a3-m1-cD (length=236) [Search sequence]

SQPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
KLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIK
MLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNLSYAE
VIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGTTICEGHHHHH

>2a1f-a3-m1-cC (length=237) [Search sequence]

Structure information

PDB ID	2a1f (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Uridylate kinase
Assembly ID	3
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	89
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P43890	P43890
Species	727 (Haemophilus influenzae)	727 (Haemophilus influenzae)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2a1f-a3-m1-cD_2a1f-a3-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2a1f-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2a1f/1/1:A/1:B 2a1f/1/1:D/1:C 2a1f/1/1:F/1:E 2a1f/2/1:F/1:E 2a1f/4/1:A/1:B
Other dimers with similar sequences but different poses	2a1f/1/1:A/1:F 2a1f/1/1:B/1:C 2a1f/1/1:E/1:D 2a1f/5/1:B/1:C