2a45/1/1:I/1:L

Sequences
>2a45-a1-m1-cI (length=40) [Search sequence]
DNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLED
>2a45-a1-m1-cL (length=44) [Search sequence]
VATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLED
Structure information
PDB ID 2a45 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the complex between thrombin and the central ""E"" region of fibrin
Assembly ID 1
Resolution 3.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I L
UniProt accession P02679 P02679
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2a45-a1-m1-cI_2a45-a1-m1-cL.pdb.gz
Full biological assembly
Download: 2a45-assembly1.cif.gz

[Back to Home]