2a6q/3/1:B/1:D

Sequences

>2a6q-a3-m1-cB (length=58) [Search sequence]

GPHMRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLL

>2a6q-a3-m1-cD (length=58) [Search sequence]

GPHMRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLL

Structure information

PDB ID	2a6q (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of YefM-YoeB complex
Assembly ID	3
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	P69346	P69346
Species	562 (Escherichia coli)	562 (Escherichia coli)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2a6q-a3-m1-cB_2a6q-a3-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2a6q-assembly3.cif.gz