2a7w/3/1:I/1:L

Sequences
>2a7w-a3-m1-cI (length=88) [Search sequence]
DVLKNIADTLEARREAAPQSSYVASLFHKGEDAILKKVAEEAAETLASKDKDKLHLVREV
ADLWFHTVLLTYHGLRPEDVVELHRREG
>2a7w-a3-m1-cL (length=88) [Search sequence]
DVLKNIADTLEARREAAPQSSYVASLFHKGEDAILKKVAEEAAETLASKDKDKLHLVREV
ADLWFHTVLLTYHGLRPEDVVELHRREG
Structure information
PDB ID 2a7w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Phosphoribosyl-ATP Pyrophosphatase from Chromobacterium violaceum (ATCC 12472). NESG TARGET CVR7
Assembly ID 3
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I L
UniProt accession Q7P0E6 Q7P0E6
Species 536 (Chromobacterium violaceum) 536 (Chromobacterium violaceum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2a7w-a3-m1-cI_2a7w-a3-m1-cL.pdb.gz
Full biological assembly
Download: 2a7w-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2a7w/1/1:A/1:D 2a7w/1/1:B/1:C 2a7w/2/1:E/1:H 2a7w/2/1:F/1:G 2a7w/3/1:J/1:K
Other dimers with similar sequences but different poses
  • 2a7w/3/1:K/1:L 2a7w/1/1:A/1:B 2a7w/1/1:C/1:D 2a7w/2/1:E/1:F 2a7w/2/1:G/1:H 2a7w/3/1:I/1:J
  • [Back to Home]