2abz/1/1:F/1:C

Sequences
>2abz-a1-m1-cF (length=58) [Search sequence]
TPDESFLCYQPDQVCAFICRGAAPLPSEGECNPHPTAPWARVEWVPTGQCRTTCIPYV
>2abz-a1-m1-cC (length=62) [Search sequence]
PDESFLCYQPDQVCAFICRGAAPLPSEGECNPHPTAPWAREGAVEWVPYSTGQCRTTCIP
YV
Structure information
PDB ID 2abz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of C19A/C43A mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
Assembly ID 1
Resolution 2.16Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 0.983
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F C
UniProt accession P81511 P81511
Species 6421 (Hirudo medicinalis) 6421 (Hirudo medicinalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2abz-a1-m1-cF_2abz-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2abz-assembly1.cif.gz

[Back to Home]