2af7/2/2:B/2:H

Sequences
>2af7-a2-m2-cB (length=114) [Search sequence]
ERYRRGEILNRNRKSYTAIRDELEDVAPDLARFVAEFAYGDVYSRGVLDLKTRELLTLAA
LTVLRADDQLKSHVRGALNAGCSKDEIIEVIQAVYAGFPAAINAVLAAKEVFTE
>2af7-a2-m2-cH (length=115) [Search sequence]
ERYRRGEILNRNRKSYTAIRDELEDVAPDLARFVAEFAYGDVYSRGVLDLKTRELLTLAA
LTVLRADDQLKSHVRGALNAGCSKDEIIEVIQAVYAGFPAAINAVLAAKEVFTEN
Structure information
PDB ID 2af7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.
Assembly ID 2
Resolution 2.81Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B H
UniProt accession O26336 O26336
Species 145262 (Methanothermobacter thermautotrophicus) 145262 (Methanothermobacter thermautotrophicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2af7-a2-m2-cB_2af7-a2-m2-cH.pdb.gz
Full biological assembly
Download: 2af7-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2af7/1/1:A/1:D 2af7/1/1:C/1:E 2af7/1/1:F/1:I 2af7/2/1:B/1:H 2af7/2/1:G/2:G
Other dimers with similar sequences but different poses
  • 2af7/2/2:G/2:H 2af7/1/1:A/1:C 2af7/1/1:E/1:F 2af7/1/1:I/1:D 2af7/2/1:B/2:B 2af7/2/1:G/1:H
  • 2af7/2/2:B/2:G 2af7/1/1:A/1:E 2af7/1/1:A/1:I 2af7/1/1:C/1:D 2af7/1/1:C/1:F 2af7/1/1:E/1:I 2af7/1/1:F/1:D 2af7/2/1:B/1:G 2af7/2/1:B/2:H 2af7/2/1:G/2:H 2af7/2/2:B/1:H 2af7/2/2:G/1:H
  • 2af7/2/1:B/2:G 2af7/1/1:A/1:F 2af7/2/1:G/2:B
  • [Back to Home]