2agy/1/1:A/1:B

Sequences

>2agy-a1-m1-cA (length=360) [Search sequence]

REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSND
GKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGK
FIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINL
GEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWS
LLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVA
RIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG

>2agy-a1-m1-cB (length=361) [Search sequence]

Structure information

PDB ID	2agy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (AADH) with tryptamine. Monoclinic form
Assembly ID	1
Resolution	1.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	16614214

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P84888	P84888
Species	511 (Alcaligenes faecalis)	511 (Alcaligenes faecalis)
Function annotation	BioLiP:2agyB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2agy-a1-m1-cA_2agy-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2agy-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2agl/1/1:A/1:B 2agw/1/1:A/1:B 2agx/1/1:A/1:B 2agz/1/1:A/1:B 2agz/2/1:A/1:B 2agz/2/2:A/2:B 2agz/2/3:A/3:B 2agz/2/4:A/4:B 2ah0/1/1:A/1:B 2ah1/1/1:A/1:B 2h3x/1/1:A/1:D 2h47/5/1:A/1:D 2h47/6/1:F/1:H 2hj4/1/1:A/1:B 2hjb/1/1:A/1:B 2hkm/1/1:A/1:B 2hkr/1/1:A/1:B 2hxc/1/1:A/1:B 2i0r/1/1:A/1:B 2i0s/1/1:A/1:B 2i0t/1/1:A/1:B 2iaa/3/1:A/1:D 2iup/1/1:A/1:B 2iuq/1/1:A/1:B 2iur/1/1:A/1:B 2iuv/1/1:B/1:A 2oiz/1/1:A/1:B 2ojy/1/1:A/1:B 2ok4/1/1:A/1:B 2ok6/1/1:A/1:B 2q7q/1/1:A/1:B