2agz/2/1:H/4:H

Sequences

>2agz-a2-m1-cH (length=114) [Search sequence]

NEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHD CCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN

>2agz-a2-m4-cH (length=114) [Search sequence]

NEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHD CCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN

Structure information

PDB ID	2agz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (AADH) with tryptamine. F222 form
Assembly ID	2
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation	16614214

Chain information

	Chain 1	Chain 2
Model ID	1	4
Chain ID	H	H
UniProt accession	P84887	P84887
Species	511 (Alcaligenes faecalis)	511 (Alcaligenes faecalis)
Function annotation	BioLiP:2agzH	BioLiP:2agzH

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2agz-a2-m1-cH_2agz-a2-m4-cH.pdb.gz

Full biological assembly Download: 2agz-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2agz/2/1:D/2:D 2agz/2/2:H/3:H 2agz/2/3:D/4:D