2ak5/1/2:A/2:B

Sequences

>2ak5-a1-m2-cA (length=60) [Search sequence]

NSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKP

>2ak5-a1-m2-cB (length=64) [Search sequence]

GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVRE IKPS

Structure information

PDB ID	2ak5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	beta PIX-SH3 complexed with a Cbl-b peptide
Assembly ID	1
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	16228008

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	O55043	O55043
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)
Function annotation	BioLiP:2ak5B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ak5-a1-m2-cA_2ak5-a1-m2-cB.pdb.gz

Full biological assembly Download: 2ak5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5sxp/2/1:D/1:B 5sxp/1/1:C/1:A