2alg/5/1:B/4:A

Sequences
>2alg-a5-m1-cB (length=92) [Search sequence]
MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP
GVNPNNAAALPGKCGVSIPYKISASTNCATVK
>2alg-a5-m4-cA (length=92) [Search sequence]
MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP
GVNPNNAAALPGKCGVSIPYKISASTNCATVK
Structure information
PDB ID 2alg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
Assembly ID 5
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID B A
UniProt accession P81402 P81402
Species 3760 (Prunus persica) 3760 (Prunus persica)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2alg-a5-m1-cB_2alg-a5-m4-cA.pdb.gz
Full biological assembly
Download: 2alg-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2alg/3/1:B/4:A 2alg/3/2:B/3:A 2alg/4/1:B/4:A 2alg/4/5:B/6:A 2b5s/3/1:A/4:B 2b5s/3/2:A/3:B 2b5s/4/1:A/4:B
Other dimers with similar sequences but different poses
  • 2alg/6/1:B/2:B 2alg/3/1:B/2:B 2b5s/3/3:B/4:B 2b5s/5/1:B/5:B
  • 2alg/3/2:B/4:A 2alg/3/1:B/3:A 2b5s/3/1:A/3:B 2b5s/3/2:A/4:B
  • 2alg/4/1:B/6:A 2alg/4/4:A/5:B
  • [Back to Home]