2ao9/1/2:E/1:A

Sequences

>2ao9-a1-m2-cE (length=115) [Search sequence]

MAKLDELKQKLTAKQIQAAYLLVENELMEEKRTQDEMANELGINRTTLWEWRTKNQDFIA FKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGDL

>2ao9-a1-m1-cA (length=117) [Search sequence]

MMAKLDELKQKLTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDF IAFKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGDL

Structure information

PDB ID	2ao9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	E	A
UniProt accession	Q81ES4	Q81ES4
Species	226900 (Bacillus cereus ATCC 14579)	226900 (Bacillus cereus ATCC 14579)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ao9-a1-m2-cE_2ao9-a1-m1-cA.pdb.gz

Full biological assembly Download: 2ao9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2ao9/1/1:E/2:A 2ao9/1/1:G/2:B 2ao9/1/1:I/2:C 2ao9/1/2:G/1:B 2ao9/1/2:I/1:C
Other dimers with similar sequences but different poses	2ao9/2/1:G/1:A 2ao9/1/1:B/1:E 2ao9/1/1:D/1:B 2ao9/1/1:D/1:C 2ao9/1/1:G/1:A 2ao9/1/1:H/1:A 2ao9/1/1:I/1:C 2ao9/1/2:B/2:E 2ao9/1/2:D/2:B 2ao9/1/2:D/2:C 2ao9/1/2:G/2:A 2ao9/1/2:H/2:A 2ao9/1/2:I/2:C 2ao9/2/1:B/1:E 2ao9/2/1:D/1:B 2ao9/2/1:D/1:C 2ao9/2/1:H/1:A 2ao9/2/1:I/1:C 2ao9/2/1:I/1:F 2ao9/1/1:H/1:E 2ao9/1/1:I/1:F 2ao9/1/2:H/2:E 2ao9/1/2:I/2:F 2ao9/2/1:H/1:E